PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 8087
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family MYB_related
Protein Properties Length: 158aa    MW: 18458.5 Da    PI: 6.8081
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
8087genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.9e-1491135347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
             8087  91 PWTEEEHKLFLLGLNKFGKGDWRSISRNFVISRTPTQVASHAQKY 135
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.13E-5158IPR009057Homeodomain-like
SMARTSM0071740153IPR001005SANT/Myb domain
PROSITE profilePS500905.854151IPR017877Myb-like domain
PROSITE profilePS5129416.92784140IPR017930Myb domain
SuperFamilySSF466891.31E-1786141IPR009057Homeodomain-like
SMARTSM007175.5E-1288138IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-1288134IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-1788138IPR006447Myb domain, plants
CDDcd001672.79E-991136No hitNo description
PfamPF002491.6E-1291135IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
WTFEEDKFFE TSLAQYDGSW PITGDDYWGQ LQEQMPQKGV HDLKNRFSKL EEDVRNIEAG  60
LVQLPDYDDD SDHHSKAAPK TGEQERRKGV PWTEEEHKLF LLGLNKFGKG DWRSISRNFV  120
ISRTPTQVAS HAQKYFIRLN SMSKKDNKRR SSIHDITS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0005831e-138CP000583.1 Ostreococcus lucimarinus CCE9901 chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001416963.11e-116predicted protein, partial
SwissprotQ8S9H74e-51DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA4RUH91e-116A4RUH9_
STRINGA4RUH91e-115(Ostreococcus lucimarinus CCE9901)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP3221529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.15e-43MYB family protein